DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc8 and Ubx

DIOPT Version :9

Sequence 1:NP_034596.1 Gene:Hoxc8 / 15426 MGIID:96198 Length:242 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:221 Identity:79/221 - (35%)
Similarity:109/221 - (49%) Gaps:60/221 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    39 VYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNP-CSLSCHGDASK--------------F 88
            |.|..|:|.|.|..            .|::.:|...|. |::|  |.|::              |
  Fly   189 VSGGNGNAGGVQSG------------VGVAGAGTAWNANCTIS--GAAAQTAAASSLHQASNHTF 239

Mouse    89 YGYEAL-------PRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHA 146
            |.:.|:       |.:|    :..:.:.||....:......||       :.:.||:..|:..:.
  Fly   240 YPWMAIAGECPEDPTKS----KIRSDLTQYGGISTDMGKRYSE-------SLAGSLLPDWLGTNG 293

Mouse   147 PGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKD 211
            . ||.|||||:|||||||||||..|.||||:||||::|||.|||||:||||||||||.|||....
  Fly   294 L-RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAI 357

Mouse   212 KLPGARDEEKVEEEGNEEEEKEEEEK 237
            |            |.||:|::.:.:|
  Fly   358 K------------ELNEQEKQAQAQK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc8NP_034596.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 8/39 (21%)
Antp-type hexapeptide 138..143 1/4 (25%)
Homeobox 153..206 CDD:395001 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 8/32 (25%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.