DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc6 and Antp

DIOPT Version :10

Sequence 1:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:118 Identity:69/118 - (58%)
Similarity:77/118 - (65%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse   109 GRTAPQDQKASIQ-------IYPWMQRMNSHSVCFVPGSLGVGYGADRRRGRQIYSRYQTLELEK 166
            |:..|..|..:.|       :||||:..             .|...:|:||||.|:|||||||||
  Fly   263 GQHTPPSQNPNSQSSGMPSPLYPWMRSQ-------------FGKCQERKRGRQTYTRYQTLELEK 314

Mouse   167 EFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGG 219
            |||||||||||||||||:||||||||||||||||||||||| |.|....|.||
  Fly   315 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE-NKTKGEPGSGG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc6XP_006520531.1 Homeodomain 150..206 CDD:459649 51/55 (93%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 15/55 (27%)
Homeodomain 298..354 CDD:459649 51/55 (93%)

Return to query results.
Submit another query.