DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc5 and Ubx

DIOPT Version :9

Sequence 1:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:233 Identity:80/233 - (34%)
Similarity:103/233 - (44%) Gaps:58/233 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 NYGSASEVQASRYCYGGLDLSITFPPPA--PSNSLHG-VDMA-ANPRAHPDRPACSAAAAPGHAL 86
            |.|:|:.........||:.:.    |.|  |.:.:.| :|.: .:|.:|....|....:..|   
  Fly   134 NGGNAANANGQNNPAGGMPVR----PSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSG--- 191

Mouse    87 GRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWM------- 144
            |...|..:..|: ....|..|.......||    ..|||...:.|.| .:....||||       
  Fly   192 GNGNAGGVQSGV-GVAGAGTAWNANCTISG----AAAQTAAASSLHQ-ASNHTFYPWMAIAGECP 250

Mouse   145 ---TKLHMSHE-----------------------------TDG--KRSRTSYTRYQTLELEKEFH 175
               ||..:..:                             |:|  :|.|.:||||||||||||||
  Fly   251 EDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFH 315

Mouse   176 FNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKD 213
            .|.|||||||||:|:.|||.||||||||||||||.||:
  Fly   316 TNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 16/76 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 15/72 (21%)
Antp-type hexapeptide 140..145 4/14 (29%)
Homeobox 158..212 CDD:395001 43/53 (81%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.