DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc4 and Antp

DIOPT Version :10

Sequence 1:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:240 Identity:86/240 - (35%)
Similarity:104/240 - (43%) Gaps:81/240 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 YIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPG 76
            |.|...|...|..||                    ||:..:|          ::|.....:..|.
  Fly   210 YTDVGVPDVTEVHQN--------------------HHNMGMY----------QQQSGVPPVGAPP 244

Mouse    77 NSRAH---GPAQAGHHHPEKSQPLCEPA--PLSGTSASPSPAPPACSQPAPDHPSSAASKQPIVY 136
            ....|   ||.|....||.:..|   |:  |.|.:|..|||                      :|
  Fly   245 QGMMHQGQGPPQMHQGHPGQHTP---PSQNPNSQSSGMPSP----------------------LY 284

Mouse   137 PWMKKIHVSTVNPNYNGG---EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSER 198
            |||:.          ..|   |.||.|..|||.|.||||||||:||||||||||||||:|||:||
  Fly   285 PWMRS----------QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTER 339

Mouse   199 QIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTS 243
            |||||||||||||||::     |.:..|.:|.....:   ||..|
  Fly   340 QIKIWFQNRRMKWKKEN-----KTKGEPGSGGEGDEI---TPPNS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 22/115 (19%)
Antp-type hexapeptide 135..140 3/4 (75%)
Homeodomain 157..213 CDD:459649 47/55 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 6/30 (20%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/160 (22%)
Homeodomain 298..354 CDD:459649 47/55 (85%)

Return to query results.
Submit another query.