DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc4 and Antp

DIOPT Version :9

Sequence 1:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:251 Identity:86/251 - (34%)
Similarity:103/251 - (41%) Gaps:95/251 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 YIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPG 76
            |.|...|...|..||                    ||:..:|          ::|.....:..|.
  Fly   210 YTDVGVPDVTEVHQN--------------------HHNMGMY----------QQQSGVPPVGAPP 244

Mouse    77 NSRAH---GPAQAGHHHPEKSQPLCEPA--PLSGTSASPSPAPPACSQPAPDHPSSAASKQPIVY 136
            ....|   ||.|....||.:..|   |:  |.|.:|..|||                      :|
  Fly   245 QGMMHQGQGPPQMHQGHPGQHTP---PSQNPNSQSSGMPSP----------------------LY 284

Mouse   137 PWMK----KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSE 197
            |||:    |..           |.||.|..|||.|.||||||||:||||||||||||||:|||:|
  Fly   285 PWMRSQFGKCQ-----------ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTE 338

Mouse   198 RQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPP 253
            ||||||||||||||||::     |.:..|.:|.               .....|||
  Fly   339 RQIKIWFQNRRMKWKKEN-----KTKGEPGSGG---------------EGDEITPP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 22/115 (19%)
Antp-type hexapeptide 135..140 3/4 (75%)
Homeobox 159..213 CDD:365835 45/53 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 6/40 (15%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/161 (22%)
Homeobox 301..354 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.