DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and Ubx

DIOPT Version :10

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:66 Identity:42/66 - (63%)
Similarity:50/66 - (75%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse   178 NWLHARSSRKK-RCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMK 241
            :||.....|:: |..||:||||||||||..|.||||.||.|:|..|.|:|||:||||||||||:|
  Fly   287 DWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351

Mouse   242 K 242
            |
  Fly   352 K 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 2/3 (67%)
Homeodomain 186..242 CDD:459649 38/56 (68%)
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 37/55 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.