DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and lms

DIOPT Version :10

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:141 Identity:44/141 - (31%)
Similarity:66/141 - (46%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse   113 QAAVKAEP-------LLGAPGELLKQGTPEYSLETSAGREA-VLSNQRAGYGDNKIC--EGSED- 166
            |:||:..|       :|..| |:....:.|.|::..:||.. .|...||.......|  :..:| 
  Fly     4 QSAVRRYPHSFSIEQILAKP-EMRSSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDG 67

Mouse   167 KERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKI 231
            |...|..:...|.|.....::.|..::..|...||.||....||:..:|..:|:.|.|:|.|:||
  Fly    68 KSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKI 132

Mouse   232 WFQNRRMKMKK 242
            ||||||.|.|:
  Fly   133 WFQNRRTKWKR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369 17/69 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 6/24 (25%)
Homeodomain 186..242 CDD:459649 23/55 (42%)
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 17/72 (24%)
Homeodomain 87..143 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.