DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb9 and eve

DIOPT Version :10

Sequence 1:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:86 Identity:37/86 - (43%)
Similarity:48/86 - (55%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   157 DNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARL 221
            ||.: .||...|.|  .:||.        |:.|..:|:.|...|||||....|::|.||.|:|..
  Fly    53 DNSL-NGSRGSEIP--ADPSV--------RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQ 106

Mouse   222 LNLSERQVKIWFQNRRMKMKK 242
            |||.|..:|:||||||||.|:
  Fly   107 LNLPESTIKVWFQNRRMKDKR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369 6/14 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 6/21 (29%)
Homeodomain 186..242 CDD:459649 28/55 (51%)
eveNP_523670.2 Homeodomain 71..127 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.