DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb7 and Ubx

DIOPT Version :9

Sequence 1:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:258 Identity:97/258 - (37%)
Similarity:117/258 - (45%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 ANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGY----GAGPGAPFSASVQG--LYSGGGAM 65
            |||.....||       |..|.:.| |...:.:..||    |..|.:....|..|  ..|||...
  Fly   139 ANANGQNNPA-------GGMPVRPS-ACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGN 195

Mouse    66 AGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWM 130
            ||...:||..||.|   :::|.:|     .:||         |.|:....|.|...||...||||
  Fly   196 AGGVQSGVGVAGAG---TAWNANC-----TISG---------AAAQTAAASSLHQASNHTFYPWM 243

Mouse   131 RSSG--------------------------------------PD-------RKRGRQTYTRYQTL 150
            ..:|                                      ||       |:||||||||||||
  Fly   244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308

Mouse   151 ELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEE 213
            |||||||.|.|||||||||:||.||||||||||||||||||.|||.:........:.:|:|::
  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 141..194 CDD:365835 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 5/22 (23%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.