DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb7 and Scr

DIOPT Version :9

Sequence 1:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:221 Identity:88/221 - (39%)
Similarity:108/221 - (48%) Gaps:56/221 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    31 SCAFASNPQRPGYGAGPGAPFS-----------------ASVQGLYS------------------ 60
            ||.:|::|..||...|.|...|                 ||.|.|.:                  
  Fly   166 SCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVAR 230

Mouse    61 --GGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPG--------DPAKAAGAKEQRD 115
              ..|.:.|..||...|||.....|...:...|...|:....||        |....||:.:  :
  Fly   231 SLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQ--N 293

Mouse   116 SDLAAESNFRIYPWMR---------SSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIA 171
            |....::..:|||||:         ::..:.||.|.:||||||||||||||:|||||||||||||
  Fly   294 SGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIA 358

Mouse   172 HTLCLTERQIKIWFQNRRMKWKKENK 197
            |.||||||||||||||||||||||:|
  Fly   359 HALCLTERQIKIWFQNRRMKWKKEHK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 4/4 (100%)
Homeobox 141..194 CDD:365835 48/52 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 5/6 (83%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.