DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb7 and unpg

DIOPT Version :9

Sequence 1:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:187 Identity:53/187 - (28%)
Similarity:77/187 - (41%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    37 NPQRPGYGAGPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGV-- 99
            :|..|....|....|..|            |.|.:.:   ...:.|.::|   ...:::.:|.  
  Fly   235 SPMEPALDVGMDEDFECS------------GDSCSDI---SLTMSPRNYN---GEMDKSRNGAYT 281

Mouse   100 ------CPGDPAKAA-------GAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLE 151
                  |..|....:       |.|:.:.:..::.|..|             |.|..:|..|.||
  Fly   282 NSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSR-------------RRRTAFTSEQLLE 333

Mouse   152 LEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWK--KENKTS-GPGTTG 205
            ||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||  |...|| |.|..|
  Fly   334 LEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 141..194 CDD:365835 30/54 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 8/17 (47%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.