DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb6 and Antp

DIOPT Version :9

Sequence 1:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:313 Identity:107/313 - (34%)
Similarity:137/313 - (43%) Gaps:83/313 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 NAPLSLPPHPFESGGGQNPPSSAKARRSDYK------------TQQIINPAEQQR---------- 78
            |..|.:|....:.   |..||..:.::...:            |||:.:|.:||:          
  Fly   103 NGQLGVPQQQQQQ---QQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKL 164

Mouse    79 ----------PR--APPL--PMSSYFVNS--TFPVTLASGQESFLGQLPLYSSGYADPLRHYPAP 127
                      |.  :|||  .||.:.:|:  |.|..:...|    .||.....|..|....:...
  Fly   165 QAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQ----AQLGYTDVGVPDVTEVHQNH 225

Mouse   128 YGPGPGQDKGFAASSYYPPAGGGY-GRAAPCDYGPAPAFYREKDAACALSGADEPPPFHPEPRKS 191
            :..|..|.:........||.|..: |:..|..:...|             |...||..:|..:.|
  Fly   226 HNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHP-------------GQHTPPSQNPNSQSS 277

Mouse   192 DCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFG--PSGRRGRQTYTRYQTLELEKEFHYNR 254
            .               ..:|:||||:       |.||  ...:|||||||||||||||||||:||
  Fly   278 G---------------MPSPLYPWMR-------SQFGKCQERKRGRQTYTRYQTLELEKEFHFNR 320

Mouse   255 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKP 307
            |||||||||||||||||||||||||||||||||||:|.........|.:|..|
  Fly   321 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb6XP_006532355.1 Homeobox 235..288 CDD:365835 51/52 (98%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 41/183 (22%)
Homeobox 301..354 CDD:395001 51/52 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2625
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.