DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb6 and unpg

DIOPT Version :9

Sequence 1:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:296 Identity:79/296 - (26%)
Similarity:107/296 - (36%) Gaps:90/296 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    35 PNAPLSLPPHPFESGGGQNPPSSAKARRSDYKTQQIINPAEQQRPRAPPLPMSSYFV------NS 93
            |..|   |||         ||:.|               .|:|.|...|.|:.:.|:      ..
  Fly   129 PQPP---PPH---------PPTHA---------------LEKQLPPTLPHPLDTRFLPFNPAAAG 166

Mouse    94 TFPVTLASGQ-ESFLGQLPLYSSGYADPLRHYPAP---------------YGPGPGQDKGFAASS 142
            ..|..|:..: ...:.|..::|......|:|..|.               ..|.|.|    |.||
  Fly   167 VAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQ----AHSS 227

Mouse   143 YYPPAGGGYGRAAPC-DYGPAPAFYREKDAACALSGADEPPPFHPEPRKS-----------DCAQ 195
              |...|.:....|. |.|....|....|:...:|....|..::.|..||           ||:.
  Fly   228 --PAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSD 290

Mouse   196 DKSV--------FGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHY 252
            |:..        .|..:.|.               |.||.....||.|..:|..|.||||:|||.
  Fly   291 DEGAQSRHEGGGMGGKDSQG---------------NGSSSNSKSRRRRTAFTSEQLLELEREFHA 340

Mouse   253 NRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 288
            .:||:...|.:||.:|.|:|.|:||||||||.|||:
  Fly   341 KKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb6XP_006532355.1 Homeobox 235..288 CDD:365835 29/52 (56%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.