DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb6 and CG32532

DIOPT Version :10

Sequence 1:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus
Sequence 2:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster


Alignment Length:53 Identity:12/53 - (22%)
Similarity:22/53 - (41%) Gaps:12/53 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   178 SFYKSKNGGGEVESVDYDRKS------RSAVITFV------VAGVADKILKKK 218
            :|..:|:.|.::..:...:.|      |....|||      :.|.|.::.|.|
  Fly    26 NFIDNKDPGFKIVKITVHQNSSDMFMDREGGYTFVNDLPHGIVGRARRMCKSK 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb6XP_006532355.1 Homeodomain 232..288 CDD:459649
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.