DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb5 and Ubx

DIOPT Version :9

Sequence 1:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:405 Identity:109/405 - (26%)
Similarity:139/405 - (34%) Gaps:159/405 - (39%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSH 65
            |:|||..: ||.|  |..:|......|   ||.:.|..|....:   .|.|..||:..|..::.|
  Fly     1 MNSYFEQA-SGFY--GHPHQATGMAMG---SGGHHDQTASAAAA---AYRGFPLSLGMSPYANHH 56

Mouse    66 FGAVGESSRAFPASAQEPRFRQATSSCSL-----SSPESLPCTN---------------GDSHG- 109
            .....:.|         |.....|::|:.     :......|.|               |.|:| 
  Fly    57 LQRTTQDS---------PYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGG 112

Mouse   110 ----------------------------------------AKPSASSPSDQ---------ATPAS 125
                                                    .:|||.:|..:         .:|.|
  Fly   113 GGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVS 177

Mouse   126 ---SSANFTEIDEASASSEPEEAASQLSSPSLARAQP--------EPMATSTAAP----EGQTPQ 175
               .||.    ...|.|.....|....|...:|.|..        ...|..|||.    :.....
  Fly   178 HRGGSAG----GNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT 238

Mouse   176 IFPWM----------RKLHISHDMT--------------------------GPDG--KRARTAYT 202
            .:|||          .|..|..|:|                          |.:|  :|.|..||
  Fly   239 FYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYT 303

Mouse   203 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD--------------N 253
            ||||||||||||.|.|||||||||:||||||:||||||||||||||.||:              .
  Fly   304 RYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQ 368

Mouse   254 KLKSMSLATAGSAFQ 268
            ..|:.:.|.|.:|.|
  Fly   369 AQKAAAAAAAAAAVQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 26/182 (14%)
Antp-type hexapeptide 176..181 3/14 (21%)
Homeobox 198..251 CDD:365835 45/52 (87%)
PRK07003 <67..>171 CDD:235906 27/188 (14%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.