DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb4 and Drgx

DIOPT Version :10

Sequence 1:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:159 Identity:43/159 - (27%)
Similarity:67/159 - (42%) Gaps:44/159 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    85 PPGLSPRAPVQPTAGALLPEPGQRSEAVSSSPPPPPCAQNPL---HPSPSHSACKEPVVYPWMRK 146
            ||.|.|..|                     .||..|....|.   ||..|:|             
  Fly     7 PPALHPCGP---------------------HPPRLPTLDYPFAATHPYTSYS------------- 37

Mouse   147 VHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEF---HYNRYLTRRRRVEIAHALCLSERQIKIW 208
            .|.:..:..:...:.:|:||.:|.||:.|||..|   ||....||.   ::|..:.|:|.::::|
  Fly    38 YHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVW 99

Mouse   209 FQNRRMKWKKDHKLPN-TKIRSGGTAGAA 236
            |||||.||:|..:|.: .:.|..|.:.::
  Fly   100 FQNRRAKWRKAERLKDEQRKRENGESSSS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 12/50 (24%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeodomain 162..218 CDD:459649 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 3/19 (16%)
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 25/58 (43%)
OAR 428..446 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.