DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb4 and Ubx

DIOPT Version :9

Sequence 1:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:225 Identity:75/225 - (33%)
Similarity:93/225 - (41%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    30 PSDHSPGYYAGGQRRESGFQPEAAFGRRAPCTVQRYAACRDPGPPPPPPPPPPPPPPGLSPRAPV 94
            ||..:|....||....||..|.:..|..|...|.......:.|                    .|
  Fly   155 PSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAG--------------------GV 199

Mouse    95 QPTAGALLPEPGQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWM------------RKV 147
            |...|.........:....|.......|.:.||.:.:|:      .||||            .|:
  Fly   200 QSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT------FYPWMAIAGECPEDPTKSKI 258

Mouse   148 H--------VST-------------VNPNYAG--GEPKRSRTAYTRQQVLELEKEFHYNRYLTRR 189
            .        :||             :.|::.|  |..:|.|..|||.|.||||||||.|.|||||
  Fly   259 RSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRR 323

Mouse   190 RRVEIAHALCLSERQIKIWFQNRRMKWKKD 219
            ||:|:||||||:||||||||||||||.||:
  Fly   324 RRIEMAHALCLTERQIKIWFQNRRMKLKKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 19/102 (19%)
Antp-type hexapeptide 140..145 4/16 (25%)
Homeobox 164..218 CDD:395001 42/53 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 0/1 (0%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.