Sequence 1: | NP_034589.3 | Gene: | Hoxb4 / 15412 | MGIID: | 96185 | Length: | 250 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368995.1 | Gene: | Scr / 40833 | FlyBaseID: | FBgn0003339 | Length: | 564 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 84/213 - (39%) |
---|---|---|---|
Similarity: | 99/213 - (46%) | Gaps: | 80/213 - (37%) |
- Green bases have known domain annotations that are detailed below.
Mouse 106 GQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHV--STVNPNYAGGEPKRSRTAY 168
Mouse 169 TRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKI------ 227
Mouse 228 --------------------------------------------------RSG------------ 230
Mouse 231 --GTAGAAGGPPGRPNGG 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hoxb4 | NP_034589.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..133 | 6/26 (23%) | |
Antp-type hexapeptide | 140..145 | 3/4 (75%) | |||
Homeobox | 164..218 | CDD:395001 | 46/53 (87%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..250 | 14/98 (14%) | |||
Scr | NP_001368995.1 | Homeobox | 328..381 | CDD:395001 | 46/52 (88%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45771 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.910 |