DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb4 and Scr

DIOPT Version :9

Sequence 1:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:213 Identity:84/213 - (39%)
Similarity:99/213 - (46%) Gaps:80/213 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse   106 GQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHV--STVNPNYAGGEPKRSRTAY 168
            |..|::.|.|......:||     ..:.....|.:||||::||:  ||||.|   ||.||.||:|
  Fly   275 GGDSDSESDSGNEAGSSQN-----SGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSY 331

Mouse   169 TRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKI------ 227
            ||.|.||||||||:|||||||||:||||||||:|||||||||||||||||:||:.:..|      
  Fly   332 TRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMG 396

Mouse   228 --------------------------------------------------RSG------------ 230
                                                              .||            
  Fly   397 PYGHPYHQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQTAAAASAASGYQSQDGGPIGGG 461

Mouse   231 --GTAGAAGGPPGRPNGG 246
              |..|.||||....|||
  Fly   462 SVGVGGGAGGPGSLANGG 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 6/26 (23%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 164..218 CDD:395001 46/53 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 14/98 (14%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.