DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb4 and CG34031

DIOPT Version :10

Sequence 1:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:86 Identity:33/86 - (38%)
Similarity:49/86 - (56%) Gaps:21/86 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse   162 KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKD------- 219
            ::.|.||:..|:..||.||:.::||:..:|||::.:|.|:|.|:|.||||||.||||.       
  Fly   134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKI 198

Mouse   220 -HK-------------LPNTK 226
             |:             :||||
  Fly   199 AHRHGLWIPTLPITTIIPNTK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Antp-type hexapeptide 140..145
Homeodomain 162..218 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 5/29 (17%)
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.