DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb4 and unpg

DIOPT Version :9

Sequence 1:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:324 Identity:88/324 - (27%)
Similarity:114/324 - (35%) Gaps:131/324 - (40%)


- Green bases have known domain annotations that are detailed below.


Mouse    28 YLPSDHSPGYYAGGQRRESG------FQPEAAFGRRAPCTVQRYAACRDPGPPPPPPPP------ 80
            |.|..|  ||:|....|.:.      :.|.:..|..|   .|:..|...|.||||.||.      
  Fly    85 YNPWLH--GYFAQNHERLTHLIAGGCYLPSSPAGHPA---AQQPQAQAQPQPPPPHPPTHALEKQ 144

Mouse    81 -PPPPPPGLSPR-APVQPTAGALLP---------------------------------------- 103
             ||..|..|..| .|..|.|..:.|                                        
  Fly   145 LPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQA 209

Mouse   104 EPGQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRK---------VHVS-TVNP-NYA 157
            .||.   |....|.||....:|. .|.|||. .||.:...|.:         ..:| |::| ||.
  Fly   210 NPGM---AQLQEPTPPQAHSSPA-KSGSHSP-MEPALDVGMDEDFECSGDSCSDISLTMSPRNYN 269

Mouse   158 G----------------------------------------------GEPKRSRTAYTRQQVLEL 176
            |                                              .:.:|.|||:|.:|:|||
  Fly   270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334

Mouse   177 EKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKK------DHKLPNTKIRSGGTAG 234
            |:|||..:||:...|.:||.:|.|||.|:||||||||.|||:      .|.|.    |:|.|:|
  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLG----RNGTTSG 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 37/158 (23%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeobox 164..218 CDD:395001 32/53 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 6/16 (38%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.