DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and ro

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:276 Identity:69/276 - (25%)
Similarity:92/276 - (33%) Gaps:103/276 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 DNTAAALFGGYSSYPGSNGFGYDGPPQPPFQAATHLEGDYQRSACSLQSLGNAAPHAKSKELNGS 72
            :.|:.|.:..|..|    |...|.|..|..|...|....:.......|.|...:|          
  Fly    95 ERTSLAAYPAYDFY----GHAKDYPQHPSQQHQQHHHHHHHPPQLVHQKLSYVSP---------- 145

Mouse    73 CMRPGLAPEPLPAPPGSPP--PSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTLTKQIFPWMKE 135
                   |..:.|...:.|  |.|.|         .|.||   .|...||.::.|.::   ..||
  Fly   146 -------PPAIAAGGAANPVLPHAFP---------AGFPS---DPHFSAGFSAFLARR---RRKE 188

Mouse   136 SRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDKSPPGSAASKRARTAYTS 200
            .||                                                     :|.||.:::
  Fly   189 GRQ-----------------------------------------------------RRQRTTFST 200

Mouse   201 AQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK------------ 253
            .|.:.||.|||.|.|:.|.||.|:|..|.|:|.||||||||||.|.|:.:||:            
  Fly   201 EQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHYRNFVVAN 265

Mouse   254 GLASSSGGPSPAGSPP 269
            |..||..|.:....||
  Fly   266 GFMSSIMGQAATTMPP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 12/62 (19%)
Antp-type hexapeptide 129..134 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 3/58 (5%)
Homeobox 195..248 CDD:365835 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 8/33 (24%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.