DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hoxb3 and btn

DIOPT Version :9

Sequence 1:	NP_001073338.1	Gene:	Hoxb3 / 15410	MGIID:	96184	Length:	433	Species:	Mus musculus
Sequence 2:	NP_732768.1	Gene:	btn / 42664	FlyBaseID:	FBgn0014949	Length:	158	Species:	Drosophila melanogaster

Alignment Length:	74	Identity:	34/74 - (45%)
Similarity:	52/74 - (70%)	Gaps:	0/74 - (0%)

- Green bases have known domain annotations that are detailed below.

Mouse   189 AASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK 253
            :::::.|||::..||.:||.||.::.||.|.||.|:|..|.|:|||:|:||||||||.|:.:..:
  Fly    84 SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEE 148

Mouse   254 GLASSSGGP 262
            ...||:..|
  Fly   149 QQGSSAKTP 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hoxb3	NP_001073338.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	63..124
		Antp-type hexapeptide	129..134
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	136..195		0/5 (0%)
		Homeobox	195..248	CDD:365835	30/52 (58%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	249..276		3/14 (21%)
		DUF4074	369..431	CDD:372548
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	389..433
btn	NP_732768.1	Homeobox	90..142	CDD:278475	30/51 (59%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X14
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900