powered by:
Protein Alignment Hoxb3 and btn
DIOPT Version :9
Sequence 1: | NP_001073338.1 |
Gene: | Hoxb3 / 15410 |
MGIID: | 96184 |
Length: | 433 |
Species: | Mus musculus |
Sequence 2: | NP_732768.1 |
Gene: | btn / 42664 |
FlyBaseID: | FBgn0014949 |
Length: | 158 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 34/74 - (45%) |
Similarity: | 52/74 - (70%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Mouse 189 AASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK 253
:::::.|||::..||.:||.||.::.||.|.||.|:|..|.|:|||:|:||||||||.|:.:..:
Fly 84 SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEE 148
Mouse 254 GLASSSGGP 262
...||:..|
Fly 149 QQGSSAKTP 157
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.