DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and abd-A

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:324 Identity:86/324 - (26%)
Similarity:112/324 - (34%) Gaps:109/324 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 QAATHLEGDYQRSACSLQSLGNA-----APHAKSKELNGSCMRPGLAPEP-LPAPPG-------- 88
            |...||....|:......||..|     ..|..||....:....|.|.:. |..||.        
  Fly   136 QQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGD 200

Mouse    89 ---SPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTL-----------------TKQIFPWM 133
               ||.|||:.:|:...|.|...|..:......:.::|..                 |.:::|::
  Fly   201 SSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYV 265

Mouse   134 KE----------------------SRQTSKLKNS----------------------------SPG 148
            ..                      ||.|..:.||                            |..
  Fly   266 SNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAA 330

Mouse   149 TAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGG-------------------------GDKSPPGS 188
            :|...|....|........|...|.||.||.|                         ||.:.|..
  Fly   331 SAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNG 395

Mouse   189 AASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 252
            ...:|.|..||..|.:|||||||||.||.|.||:|:|:.|.|:||||||||||||||.||:.:|
  Fly   396 CPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 17/72 (24%)
Antp-type hexapeptide 129..134 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 20/111 (18%)
Homeobox 195..248 CDD:365835 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 1/4 (25%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.