DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and Antp

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:288 Identity:84/288 - (29%)
Similarity:108/288 - (37%) Gaps:105/288 - (36%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 QAATHLEGDYQR----SACSLQS----LGNAAPHAKS----KELNGSCMRPGLAPEPLPAPPGSP 90
            |..||.:...|:    ::|.||:    || ..|...|    .:::|..|.   |...||...|.|
  Fly   144 QQVTHPQQQQQQPVVYASCKLQAAVGGLG-MVPEGGSPPLVDQMSGHHMN---AQMTLPHHMGHP 204

Mouse    91 ---------------------------------PPSAAPTSTTSNSNNG------GGPSKSGPPK 116
                                             ||..||.....:...|      |.|.:..||.
  Fly   205 QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS 269

Mouse   117 CGAGSNST-LTKQIFPWMKESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGG 180
            ....|.|: :...::|||:.  |..|.:.                                    
  Fly   270 QNPNSQSSGMPSPLYPWMRS--QFGKCQE------------------------------------ 296

Mouse   181 GDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMK 245
                      .||.|..||..|.:||||||||||||.|.||:|:|:.|.|:||||||||||||||
  Fly   297 ----------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351

Mouse   246 YKKDQKAKGLASSSGGPSPAGSPPQPMQ 273
            :||:.|.|| ...|||.....:||...|
  Fly   352 WKKENKTKG-EPGSGGEGDEITPPNSPQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 18/103 (17%)
Antp-type hexapeptide 129..134 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 4/58 (7%)
Homeobox 195..248 CDD:365835 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 9/25 (36%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 34/196 (17%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.