DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and Scr

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:461 Identity:131/461 - (28%)
Similarity:170/461 - (36%) Gaps:130/461 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 YDNTAAALFGGYSSYPGSNGFGYDGPPQPPFQAATHLEGDYQRSACSLQSLGNAAPHAKSKELNG 71
            |.||..|.:        :|...|.|...|.....|.|:.  ||.....|.......||.:.....
  Fly    87 YPNTPQAHY--------ANQAAYGGQGNPDMVDYTQLQP--QRLLLQQQQQQQQQQHAHAAAAVA 141

Mouse    72 SCMRPGLAPEPLPA----------------PPGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAG 120
            :..:..||.:..|.                .|.:|..|.....:.||:||....|.:...:..|.
  Fly   142 AQQQQQLAQQQHPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLAS 206

Mouse   121 SNSTLTKQIFPWMKES-------RQTSK--LKNSSPGTAEGCG------GGGGGGGGGG------ 164
            .....|:.|.|.:..|       |..:|  |..|....|...|      |.|..||.|.      
  Fly   207 PQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMH 271

Mouse   165 --GGG-------GGSSGGGGGGGGGGDKSPP-----------------GSAASKRARTAYTSAQL 203
              |||       .|:..|.....|.|.|:||                 .:..:||.||:||..|.
  Fly   272 SPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQT 336

Mouse   204 VELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGP---SPA 265
            :||||||||||||.|.||:|:|:.|.|:||||||||||||||:||:.|   :||.:..|   .|.
  Fly   337 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK---MASMNIVPYHMGPY 398

Mouse   266 GSPPQPMQ---STAGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLKGCGAPQKYPPT 327
            |.|.....   |....::| .:...|         |.| :    |...||.|.:...|     .:
  Fly   399 GHPYHQFDIHPSQFAHLSAXDAWHFS---------GTGXR----LNQLYQEPYQTAAA-----AS 445

Mouse   328 PASEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSLYGLNHLSHHPSGNLDYNGA 392
            .||.|:    ..:||..|     |..|.||||.        .||             |:|...|:
  Fly   446 AASGYQ----SQDGGPIG-----GGSVGVGGGA--------GGP-------------GSLANGGS 480

Mouse   393 APMGPN 398
            ...|||
  Fly   481 NGSGPN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 14/76 (18%)
Antp-type hexapeptide 129..134 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 24/105 (23%)
Homeobox 195..248 CDD:365835 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 8/32 (25%)
DUF4074 369..431 CDD:372548 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 4/10 (40%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.