DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and Dfd

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:579 Identity:129/579 - (22%)
Similarity:168/579 - (29%) Gaps:282/579 - (48%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 YYDNTA-----AALFGGYSSYPGSNGFGYDGPPQPPF---QAATHLEGDYQRSACSLQSLGNAAP 62
            ::.|:|     .|..|||||     .:....||..|.   .|..|            ||||....
  Fly   110 HHSNSAISGHHQASAGGYSS-----NYANATPPSHPHSHPHAHPH------------QSLGYYVH 157

Mouse    63 HAKSKELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTLTK 127
            |               |||.:.|           .:..|:..||.||:.                
  Fly   158 H---------------APEFISA-----------GAVHSDPTNGYGPAA---------------- 180

Mouse   128 QIFPWMKESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGG----------- 181
                             :.|.|:.|.||||.|...|||..|||:.|..||.|||           
  Fly   181 -----------------NVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGST 228

Mouse   182 ----------------------------------------------------------------- 181
                                                                             
  Fly   229 HSQGHSPHSQMMDLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMG 293

Mouse   182 --------------DKSP----------------------------------------------- 185
                          |:||                                               
  Fly   294 SENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANG 358

Mouse   186 ---PGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYK 247
               || ...||.|||||..|::|||||||:||||.|.||:|:|:.|.||||||||||||||||:|
  Fly   359 SYQPG-MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWK 422

Mouse   248 KDQK-------AKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAY 305
            ||.|       .|....::|.|:|...                       .|:..|..|..|.|.
  Fly   423 KDNKLPNTKNVRKKTVDANGNPTPVAK-----------------------KPTKRAASKKQQQAQ 464

Mouse   306 ALPSNYQPPLKGCGAPQKYPPTPASE--YEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPP 368
            ....:.|         |:...||...  .....|::.|   ...:..|:|.|:       |..|.
  Fly   465 QQQQSQQ---------QQTQQTPVMNECIRSDSLESIG---DVSSSLGNPPYI-------PAAPE 510

Mouse   369 AGPSLYG-LNHLSHHPSGNLDYNGAAPMGPNQHHGPCDPHPTYTDLSSHHAPPQGRIQE 426
            ...|..| ..|||     |.:.||:.....|.::...:.:....:....|....|.:|:
  Fly   511 TTSSYPGSQQHLS-----NNNNNGSGNNNNNNNNNNSNLNNNNNNNQMGHTNLHGHLQQ 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 10/60 (17%)
Antp-type hexapeptide 129..134 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 27/198 (14%)
Homeobox 195..248 CDD:365835 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 6/33 (18%)
DUF4074 369..431 CDD:372548 12/59 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 6/38 (16%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.