DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and bcd

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:248 Identity:63/248 - (25%)
Similarity:89/248 - (35%) Gaps:71/248 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   192 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYK------KDQ 250
            :|.||.:||:|:.|||:.|...|||..||..:::..|.|...|:||||:|||.::|      |||
  Fly    98 RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQ 162

Mouse   251 KAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPL 315
            ..:|:..|.|.....|.||.....:.|     ...||:..:|||.                    
  Fly   163 SYEGMPLSPGMKQSDGDPPSLQTLSLG-----GGATPNALTPSPT-------------------- 202

Mouse   316 KGCGAPQKYPPTPASEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYAD-------PLPPPAGPSL 373
                     |.||.:....|..::....|.         |.||..:|.       ..|...||. 
  Fly   203 ---------PSTPTAHMTEHYSESFNAYYN---------YNGGHNHAQANRHMHMQYPSGGGPG- 248

Mouse   374 YGLNHLSHHPSGNLDYNGAAPMGPNQHHGPCDPHPTYTDLSSHHAPPQGRIQE 426
                      .|:.:.||.......|.|.    |........:|.|.|.:.|:
  Fly   249 ----------PGSTNVNGGQFFQQQQVHN----HQQQLHHQGNHVPHQMQQQQ 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124
Antp-type hexapeptide 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 1/2 (50%)
Homeobox 195..248 CDD:365835 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 8/26 (31%)
DUF4074 369..431 CDD:372548 12/58 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 9/38 (24%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 21/46 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.