DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and zen

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:215 Identity:69/215 - (32%)
Similarity:89/215 - (41%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   192 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLA 256
            ||:|||:||.||||||.||..|.||.|.||:|:|..|:|.|||:||||||||||:|||       
  Fly    91 KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKD------- 148

Mouse   257 SSSGGPSPAG----SPPQPMQST-AGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLK 316
             ..|...|..    :.||..||. .|.:..|.|.:                         |.|.:
  Fly   149 -IQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYS-------------------------QDPRE 187

Mouse   317 GCGAPQKYP--------PTP---ASEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAG 370
            |..|.:|.|        |.|   ||:........|.|...:..:.....::.....|..:.....
  Fly   188 GTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVSTATS 252

Mouse   371 PSLYGLNHLSHHPSGNLDYN 390
            .:....|..|...||:..||
  Fly   253 STGTSTNSASSSSSGHYSYN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124
Antp-type hexapeptide 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 2/2 (100%)
Homeobox 195..248 CDD:365835 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 7/31 (23%)
DUF4074 369..431 CDD:372548 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 2/2 (100%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.