DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and pb

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:359 Identity:104/359 - (28%)
Similarity:144/359 - (40%) Gaps:79/359 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 GGYSSYPGSNGFGYDG-PPQPPFQAATHLEGDY-QRSA-------CSLQSLGNAAPHAKSKELNG 71
            ||.....|..|.|..| ||.|.......:..:. :|||       .|.....|:.| :.::.|| 
  Fly    50 GGVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQP-SMAEFLN- 112

Mouse    72 SCMRPGLAPE--PLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTLTKQIFPWMK 134
                 .|:||  .:..|.||........:...|...|.|......|:...|.:|.   ..:||||
  Fly   113 -----HLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSV---PEYPWMK 169

Mouse   135 ESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDKS----PPGSAASKRAR 195
            |.:.:.|..|::                                ..||.|    .|.:...:|.|
  Fly   170 EKKTSRKSSNNN--------------------------------NQGDNSITEFVPENGLPRRLR 202

Mouse   196 TAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK-----GL 255
            ||||:.||:|||||||||:|||||||:|:|..|:|:|||:|:||||||||:|:...:|     ..
  Fly   203 TAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNK 267

Mouse   256 ASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLKGCGA 320
            .|..|....:.|.....:|..|      ...||.|.|...:..:||.|.....:|..|.....  
  Fly   268 DSLKGDDDQSDSNSNSKKSCQG------CELPSDDIPDSTSNSRGHNNNTPSATNNNPSAGNL-- 324

Mouse   321 PQKYPPTPASEYEPHVLQANGGAYGTPTMQGSPV 354
                  ||.|..|..:   :....|:.|:..|.|
  Fly   325 ------TPNSSLETGI---SSNLMGSTTVSASNV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 13/62 (21%)
Antp-type hexapeptide 129..134 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 7/62 (11%)
Homeobox 195..248 CDD:365835 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 5/31 (16%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
pbNP_476669.3 COG5576 168..274 CDD:227863 53/137 (39%)
Homeobox 202..254 CDD:278475 39/51 (76%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.