DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and Awh

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:194 Identity:46/194 - (23%)
Similarity:70/194 - (36%) Gaps:47/194 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse   167 GGGSSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLS 231
            ||.:|...|..|.|..||     .:||.||.:|..||..|:..|..:..........:|::..||
  Fly   129 GGTTSSDEGCDGDGYHKS-----KTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLS 188

Mouse   232 ERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPA 296
            :|..::||||.|.:.||.                                :|:.......|...:
  Fly   189 KRVTQVWFQNSRARQKKH--------------------------------IHAGKNKIREPEGSS 221

Mouse   297 FGKGHQN---AYALPSNYQPPLKGCGAPQKYPPTPASEYEPHVLQANGGAYGTPT----MQGSP 353
            |.: |.|   .|:..:|.|.|:...|:.....||..|..:.  |..:...:..|:    .|.||
  Fly   222 FAR-HINLQLTYSFQNNAQNPMHLNGSKAGLYPTHESSMDE--LSQDSSVHCMPSEVXLEQSSP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124
Antp-type hexapeptide 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 10/27 (37%)
Homeobox 195..248 CDD:365835 16/52 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 0/26 (0%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.