DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and cad

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:403 Identity:98/403 - (24%)
Similarity:138/403 - (34%) Gaps:130/403 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 YYD-----NTAAALFGGYSSYPGS---NGFGYDGPP---QPPFQAATHLEGDYQRSACSLQSLGN 59
            ||:     ::|||...|....|.|   :.|..:.|.   |...|...|.......||.|..|...
  Fly    65 YYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGSSSSG 129

Mouse    60 AAPHA-KSKELNGSC----------------MRPGLAP--------EPLPAP-----------PG 88
            .||.| :..|.|.|.                ..||.||        |.||:|           ||
  Fly   130 GAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPG 194

Mouse    89 SPPPSAAP-------TSTTSNSNNGGGPSKSGPPKCGAGSNSTLTKQ----------IFPWMKES 136
            :|..:::|       .|..:|:||....:.:.|......:|:.....          .|.|||:.
  Fly   195 APTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKP 259

Mouse   137 RQTSKLK---NSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDKSPPGSAASK-----R 193
            ...::.:   :|||...                               |.|....|:.|     :
  Fly   260 AYPAQPQPDLSSSPNLE-------------------------------DLSDLLDASGKTRTKDK 293

Mouse   194 ARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASS 258
            .|..||..|.:|||||:..:||:...|:.|:|..|:|||||:||||||||.|.:|..|       
  Fly   294 YRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK------- 351

Mouse   259 SGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLKGCGAPQK 323
                  .||.|..|  ..|..:|.:|......:...|.....|..|:::            .|..
  Fly   352 ------KGSDPNVM--GVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSM------------NPMA 396

Mouse   324 YPPTPASEYEPHV 336
            ....||....||:
  Fly   397 AMNIPAMRLHPHL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 22/103 (21%)
Antp-type hexapeptide 129..134 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 7/66 (11%)
Homeobox 195..248 CDD:365835 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 5/26 (19%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
cadNP_001260641.1 Homeobox 295..347 CDD:278475 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.