DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and bsh

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster


Alignment Length:307 Identity:91/307 - (29%)
Similarity:112/307 - (36%) Gaps:87/307 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 ATYYDNTAAALFGG------YSSYPGSNGFGYDGPPQPPFQAATHLEGDYQRSACSLQSLGNAAP 62
            ||...|.||:.:.|      ..|.|.||.....|        .:|..|| |.|    |.||    
  Fly   123 ATARSNQAASGYAGEDYGKSMHSTPRSNHHSRHG--------TSHYNGD-QIS----QQLG---- 170

Mouse    63 HAKSKELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSG---PPKCGAGSNST 124
                   :|:...|.: |...|.||  |||..          |||..:.:|   |       |:.
  Fly   171 -------SGAAQHPPV-PTTQPQPP--PPPPL----------NGGSGASNGVLYP-------NAP 208

Mouse   125 LTKQIFPWMK---ESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDKSPP 186
            .|...|..|.   .|..:...|:..|.........||....|..|.......|.|.|....:   
  Fly   209 YTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALR--- 270

Mouse   187 GSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKD-- 249
             ....::|||.::..||..|||.|...|||..|.|||:|..|.|||.|:|.||||||||:||.  
  Fly   271 -HCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLR 334

Mouse   250 ----------------QKAKGLASSSGGPSP---------AGSPPQP 271
                            .|..|.|:||.|.|.         .|:|.||
  Fly   335 RRDNANEPVDFSRSEPGKQPGEATSSSGDSKHGKLNPGSVGGTPTQP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 15/63 (24%)
Antp-type hexapeptide 129..134 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 10/58 (17%)
Homeobox 195..248 CDD:365835 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 11/50 (22%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.