DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and al

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:360 Identity:91/360 - (25%)
Similarity:123/360 - (34%) Gaps:112/360 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    87 PGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTLTKQIFPWMKESRQTSKLKNSSPGTAE 151
            |||...||....|.|.|.:||.||                                         
  Fly    31 PGSSAASAGAALTVSMSVSGGAPS----------------------------------------- 54

Mouse   152 GCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYL 216
                    |..|..||..|....|......|:..| ....:|.||.:||.||.||||.|....|.
  Fly    55 --------GASGASGGTNSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYP 110

Mouse   217 CRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGP-SPAGS-----------PP 269
            ....|.|:|..:.|:|.:|::||||||.|::|.:|. |..|....| .|.|:           ||
  Fly   111 DVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV-GPQSHPYNPYLPGGAATMQTVVGAALPP 174

Mouse   270 QPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAY-ALPSNYQPPLKGCGAPQKYPP------- 326
            .|. :..||.  |.....:..:.:..||...|.:|. .:||.|....      |:.||       
  Fly   175 NPF-THLGFQ--LRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQF------QRAPPHMLPHGM 230

Mouse   327 ----TPASEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSLYGLNHLSHHPSGNL 387
                :|:|.::..:........|||..:...:.||            .|.|:..||:...|    
  Fly   231 AGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVG------------SPDLHSPNHMLASP---- 279

Mouse   388 DYNGAAPMGP-NQHHGPCDPHPTYTDLSSHHAPPQ 421
                  |..| :.|......|||     :|..|||
  Fly   280 ------PTSPASGHASQHQQHPT-----AHPPPPQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 12/36 (33%)
Antp-type hexapeptide 129..134 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 9/58 (16%)
Homeobox 195..248 CDD:365835 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 9/38 (24%)
DUF4074 369..431 CDD:372548 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 10/34 (29%)
alNP_722629.1 Homeobox 89..141 CDD:278475 25/51 (49%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.