DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and OdsH

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:282 Identity:67/282 - (23%)
Similarity:98/282 - (34%) Gaps:73/282 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   169 GSSGG--------GGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMA 225
            |||.|        .|.....|......|:..:|.||.:.|.||.|||:.|..:.|.....|..:|
  Fly   128 GSSRGIKQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALA 192

Mouse   226 NLLNLSERQIKIWFQNRRMKYKKDQ---KAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHS--M 285
            ..|:|.|.:|.:||||||.|::|.:   |..|..:.:..|......|.|:........|..|  |
  Fly   193 TKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPLSELRARELAQRSKRM 257

Mouse   286 TPSYDSPSPPAFGKGHQNAYA-LPSNYQPPLKGCGAPQKYPPTPASEYEPHVLQANGGAYGTPTM 349
            ..:.|..:.....||.:..|| |.:.|.                |:..|..|.:.|         
  Fly   258 KKAIDRQAKKLQDKGLEVDYARLEAEYL----------------AAHQENGVDENN--------- 297

Mouse   350 QGSPVYVGGGGYADPLPPPAGPSLYGLNHLSHHPSGNLDYNGAAP---MGPNQHHGPCDPH---- 407
                 ::...||.|.                     ::|..|..|   .|.:..|..|...    
  Fly   298 -----WLDDDGYDDL---------------------HIDVVGVEPEYVTGDSLDHSFCSSRTYQT 336

Mouse   408 -PTYTDLSSHHAPPQGRIQEAP 428
             .|.::|.|:....|||::..|
  Fly   337 KSTSSELDSNDMGLQGRVETPP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124
Antp-type hexapeptide 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 8/33 (24%)
Homeobox 195..248 CDD:365835 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 5/29 (17%)
DUF4074 369..431 CDD:372548 13/68 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 12/48 (25%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.