DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and unc-4

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:417 Identity:101/417 - (24%)
Similarity:132/417 - (31%) Gaps:118/417 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 GYSSYPGSNGFGYDGPPQPPFQAATHLEGDYQRSACSLQSLGNAAPH-----AKSKELNGSCMRP 76
            |.||...||..    |......|..||.|....||||....|...|.     ..:.:|..:..: 
  Fly    46 GRSSSTSSNSI----PNAHRTNAGQHLLGGSPSSACSTSVSGCGMPSEGLHPTAALQLYAAAAQ- 105

Mouse    77 GLAPEPLPAPPGSP------PPSAAPTSTTSNSNNGGGPSKSGPPKCGA------------GSN- 122
             |||..:..||..|      |....|.............|..|.|...|            .|| 
  Fly   106 -LAPNGVRVPPWGPFLQFGVPGVFGPNGPFLGRPRFDAASAGGHPNSAAAAAAATQMAAVNASNA 169

Mouse   123 -STLTKQIFPWMKESRQTSKLKNSSPGTAEGCG---------------GGGGGGGGGGGGGGGSS 171
             :.||         ....:.|:|.|........               |........|....||:
  Fly   170 FANLT---------GLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPPAGPPSEGSN 225

Mouse   172 GGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIK 236
            ..||..|.|.|.|  .:|..:|:||.:.|.||.|||:.|..:.|.....|..:|..|:|.|.::.
  Fly   226 EDGGFPGDGDDDS--SAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVA 288

Mouse   237 IWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGH 301
            :||||||.|.:|.:..|      .||.......|| |:.:|             .|.||...|..
  Fly   289 VWFQNRRAKVRKREHTK------KGPGRPAHNAQP-QTCSG-------------EPIPPNELKAK 333

Mouse   302 QNA--------------------------YALPSNYQPPLKGCGAPQKYPPTPASEYEPHVLQAN 340
            :.|                          .||.:.|....|..|.      ...|:.|...:|.:
  Fly   334 ERARRRKKLAKAIDRQARKLQAKGITVDLEALKAEYISQHKANGT------FSDSDLEDDGIQID 392

Mouse   341 --GGAYGTPTMQG-----SPVYVGGGG 360
              ||.....  :|     |||.:||||
  Fly   393 VVGGTDSDD--EGDSDAVSPVRLGGGG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 15/85 (18%)
Antp-type hexapeptide 129..134 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 15/73 (21%)
Homeobox 195..248 CDD:365835 22/52 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 6/26 (23%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 22/52 (42%)
NK <327..>368 CDD:302627 5/40 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.