DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb3 and CG11294

DIOPT Version :9

Sequence 1:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:261 Identity:59/261 - (22%)
Similarity:75/261 - (28%) Gaps:110/261 - (42%)


- Green bases have known domain annotations that are detailed below.


Mouse   187 GSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQK 251
            |....:|.||.:|..||.|||..|....|.....|.|:|..::|||.::::||||||.|::|..:
  Fly    20 GRRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQAR 84

Mouse   252 AKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLK 316
            .:                  :...|..|..|...||                             
  Fly    85 LQ------------------LLQDAWRMRCLSLGTP----------------------------- 102

Mouse   317 GCGAPQKYPPTPASEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSLYGLNHLSH 381
                                          |.|.|..|..|.|..|...||...|.    |..|.
  Fly   103 ------------------------------PVMGGGAVQGGSGNGATARPPSQTPE----NLSSA 133

Mouse   382 HPSGNLDYNGAAP-------MGP--------NQHHGPCDPH----------PTYTDLSSHHAPPQ 421
            .....|...|..|       |.|        .||.|    |          .|||:|..:.||..
  Fly   134 SKDSELAEVGNGPNSGSFTMMHPAFQQQHQQQQHQG----HQQATDQDKLSKTYTELKLYKAPSH 194

Mouse   422 G 422
            |
  Fly   195 G 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124
Antp-type hexapeptide 129..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 2/7 (29%)
Homeobox 195..248 CDD:365835 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 0/26 (0%)
DUF4074 369..431 CDD:372548 19/79 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433 15/59 (25%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 22/50 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.