DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC2A12 and CG33282

DIOPT Version :9

Sequence 1:NP_660159.1 Gene:SLC2A12 / 154091 HGNCID:18067 Length:617 Species:Homo sapiens
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:571 Identity:120/571 - (21%)
Similarity:218/571 - (38%) Gaps:165/571 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    38 MFTFLSS------------VTAAVSGLLVGYELGI--ISGALLQIKTL-----LALSCHEQEMVV 83
            |.|||.:            .|..|:.:..|:.:|:  :|..|.:|:|.     ..::..:...:.
  Fly     1 MATFLKNSLLQQKTRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLG 65

Human    84 SSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLILSLSYTV-----LIVGRIAIGVS 143
            |.|.:.:|..:||..:||:|.||:..:.|.:     |....|..|.|..     |...|...|.:
  Fly    66 SMLGLDSLCGNLTIAMLIERAGRKFCLYLMA-----GPYACIWILIYCASNVYYLYAARFLCGFT 125

Human   144 ISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILSAYI-SNYAFANVFHGWKYMFGLVIPLG 207
            .....:...::|:|:|..:.||.|.|:..|.:.:|||:.|| |.|.   .:|...:   |.|.|.
  Fly   126 GGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILSTYL---AYHVVPF---LAIILP 184

Human   208 VLQAIAMYFLPPSPRFLVMKGQEGAASKVLGRLR----ALSDTTEELTVIKSSLKDEYQYSFWDL 268
            |...||...||.:..:|:.|.|..||.......|    |:.:.|.::             :|.:|
  Fly   185 VAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKV-------------NFEEL 236

Human   269 FRSKDNMRTRIMIGLTLVFFVQITGQPNILFYASTVLKSVGFQSNEAASL--------------- 318
            ..:..:.:||   ..|.:.:..:|.:|.:..:|::::.|:|:|.:...|.               
  Fly   237 RTAVLSQQTR---NATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVV 298

Human   319 ----ASTGVGVVKVISTIPATLLVDHVGSKTFLCIGSSVMAASLVTMGIVNLNIHMNFTHICRSH 379
                |:..:|:|:::....:|:|||.||.:..:.|.:..:....:..|.        ||::.:  
  Fly   299 DVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGC--------FTYLAK-- 353

Human   380 NSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLMPLRNDVDKRGETTSASLLNAGLSH 444
                       ||   :||..|                                           
  Fly   354 -----------IY---DLSDFN------------------------------------------- 361

Human   445 TEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWG 509
                             ||.|..:::.....:|||..:.:|||.|:||..||..|.:|:...   
  Fly   362 -----------------WLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSVIF--- 406

Human   510 INLLISLT---FLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSL 557
            ::||:..|   |..:....|:.:..:.....:|.:..:..:|:.||||.|:
  Fly   407 LSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSM 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC2A12NP_660159.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Sugar_tr 44..561 CDD:306568 116/565 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 110/540 (20%)
MFS_1 53..409 CDD:284993 96/469 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.