DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb1 and Scr

DIOPT Version :9

Sequence 1:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:102/269 - (37%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 GGGLPSSALQQNSGYPVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYY-SVGQSEGDGSYFH 109
            |||:..|....||.........||.      :|...:....:|...||... ||.:|...|....
  Fly   181 GGGVSGSNNNNNSANSNNNNSQSLA------SPQDLSTRDISPKLSPSSVVESVARSLNKGVLGG 239

Mouse   110 PSSYGAQLGGLPDSYGAGGVGSGP---YPPPQPPYGTEQTATFASAYDLLSEDKESPCSSEPSTL 171
            ..:..|...||.:::...||..||   ..|...|.|.:..:...|..:..|..........|   
  Fly   240 SLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNP--- 301

Mouse   172 TPRTFDWMKVKRNPPKTGRAQRSHF-LSLARAYTEGPEPGLHSFLQLLLLAAKVSELGLGAPGGL 235
             |:.:.|||            |.|. .|...|..|....                          
  Fly   302 -PQIYPWMK------------RVHLGTSTVNANGETKRQ-------------------------- 327

Mouse   236 RTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGR--MP 298
            ||::|..|..|||||||||:||:|.||:|||..|.|.|.|:||||||||||.||..:....  :|
  Fly   328 RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVP 392

Mouse   299 --AGPPGCP 305
              .||.|.|
  Fly   393 YHMGPYGHP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 35/52 (67%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.