DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb1 and zen2

DIOPT Version :9

Sequence 1:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:101 Identity:45/101 - (44%)
Similarity:55/101 - (54%) Gaps:11/101 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse   236 RTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAG 300
            ||.|::.||.|||:|||.||||:|.||:||:..|.|.|.||||||||||||.||.....|.:.|.
  Fly    47 RTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGAL 111

Mouse   301 PPGCPKEAAGDASDQS-----------ACTSPEASP 325
            ....|..:......|.           |.|:.|.:|
  Fly   112 TTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 35/52 (67%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.