DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb1 and unpg

DIOPT Version :9

Sequence 1:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:343 Identity:102/343 - (29%)
Similarity:132/343 - (38%) Gaps:93/343 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 EYPLCNRGPSAYSA--PTSFPPCSAPAVDSYAGESR------YGGG--LPSSALQQNSGYP-VQQ 64
            |..|..|...|.||  .|.||..: |.:..|..::.      ..||  ||||.    :|:| .||
  Fly    63 EQELSARAMVASSALGLTQFPLYN-PWLHGYFAQNHERLTHLIAGGCYLPSSP----AGHPAAQQ 122

Mouse    65 PPSSLGVSFPSPAPSGYA---------PAACNPSYGPSQYYSVGQSEGDGS-----------YFH 109
            |.:......|.|.|..:|         |...:..:.|....:.|.:..|.|           |.|
  Fly   123 PQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVH 187

Mouse   110 PSSYGAQLGGLPDSYGAGGV-------GSGPYPPPQPPYGTEQTATFAS------AYDL-LSEDK 160
            ..|..|:|..:.   .||.:       |......|.||......|...|      |.|: :.||.
  Fly   188 SLSVHARLQHMA---AAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDF 249

Mouse   161 E---SPCSSEPSTLTPRTFDW-MKVKRNPPKTGR----------AQRSHFLSLARAYTEGPEPGL 211
            |   ..||....|::||.::. |...||...|..          ||..|         ||...| 
  Fly   250 ECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH---------EGGGMG- 304

Mouse   212 HSFLQLLLLAAKVSELGLGAPGG-----LRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLEL 271
                      .|.|: |.|:...     .||.||:.||.|||:|||..||||...|.:||.:|:|
  Fly   305 ----------GKDSQ-GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKL 358

Mouse   272 NETQVKIWFQNRRMKQKK 289
            :|.||||||||||.|.|:
  Fly   359 SEVQVKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 33/52 (63%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.