DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and Abd-B

DIOPT Version :9

Sequence 1:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:192 Identity:62/192 - (32%)
Similarity:89/192 - (46%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 SSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSPLYQSPF 66
            :::.|:|......:|.|.  |:.|.||        .|.|.|                 |.|.||.
  Fly   308 AAAAYMNEAERHVSAAAR--QSVEGTS--------TSSYEP-----------------PTYSSPG 345

Mouse    67 A-SGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMRSSGPDRK 130
            . .||         |..:|..:  |....|:.||.         ||...:..::.|.......:|
  Fly   346 GLRGY---------PSENYSSS--GASGGLSVGAV---------GPCTPNPGLHEWTGQVSVRKK 390

Mouse   131 RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDES 192
              |:.|:::|||||||||.||.|:::::|.|:|..|.|||||:||||||||||.||..:.::
  Fly   391 --RKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 1/4 (25%)
Homeobox 133..185 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 1/7 (14%)
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 34/54 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.