Sequence 1: | NP_034585.1 | Gene: | Hoxa7 / 15404 | MGIID: | 96179 | Length: | 229 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368995.1 | Gene: | Scr / 40833 | FlyBaseID: | FBgn0003339 | Length: | 564 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 88/201 - (43%) |
---|---|---|---|
Similarity: | 106/201 - (52%) | Gaps: | 47/201 - (23%) |
- Green bases have known domain annotations that are detailed below.
Mouse 1 MSSSYYVNAL---FSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSPLY 62
Mouse 63 QSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMR---- 123
Mouse 124 -----SSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 183
Mouse 184 WKKEHK 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hoxa7 | NP_034585.1 | Antp-type hexapeptide | 118..123 | 4/4 (100%) | |
Homeobox | 133..185 | CDD:278475 | 49/51 (96%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 186..229 | 4/4 (100%) | |||
Scr | NP_001368995.1 | Homeobox | 328..381 | CDD:395001 | 50/52 (96%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.810 |