DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and Scr

DIOPT Version :10

Sequence 1:NP_001406200.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:270 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:93 Identity:65/93 - (69%)
Similarity:70/93 - (75%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse   139 GELRPPGSLTHHCTRGHF-QNGAEANGTEGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIE 202
            |:..|| .:.....|.|. .:...|||    :.||.|.:||||||||||||||||||||||||||
  Fly   297 GKKNPP-QIYPWMKRVHLGTSTVNANG----ETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIE 356

Mouse   203 IAHALCLTERQIKIWFQNRRMKWKKEHK 230
            ||||||||||||||||||||||||||||
  Fly   357 IAHALCLTERQIKIWFQNRRMKWKKEHK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_001406200.1 Homeodomain 171..227 CDD:459649 52/55 (95%)
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 52/55 (95%)

Return to query results.
Submit another query.