DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and Scr

DIOPT Version :9

Sequence 1:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:201 Identity:88/201 - (43%)
Similarity:106/201 - (52%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSSSYYVNAL---FSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSPLY 62
            :|.|..|.::   .:|...|.||...|.....    |:..||.|...|      ||  |||.|::
  Fly   219 LSPSSVVESVARSLNKGVLGGSLAAAAAAAGL----NNNHSGSGVSGG------PG--NVNVPMH 271

Mouse    63 QSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMR---- 123
             ||........:|:.|                 ..|:...:..|..:.|     :|||||:    
  Fly   272 -SPGGGDSDSESDSGN-----------------EAGSSQNSGNGKKNPP-----QIYPWMKRVHL 313

Mouse   124 -----SSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 183
                 ::..:.||.|.:||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   314 GTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 378

Mouse   184 WKKEHK 189
            ||||||
  Fly   379 WKKEHK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 4/4 (100%)
Homeobox 133..185 CDD:278475 49/51 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 4/4 (100%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.