DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and bcd

DIOPT Version :9

Sequence 1:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:111 Identity:35/111 - (31%)
Similarity:46/111 - (41%) Gaps:31/111 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse   130 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK---KEHKDE 191
            :|.|.|:|..|..|||:.|...||||..|..:::..|.|...|:||||:|||.:.|   .:|||:
  Fly    98 RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQ 162

Mouse   192 S----------------------------QAPTAAPEDAVPSVSTA 209
            |                            ..|.|......||..||
  Fly   163 SYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123
Homeobox 133..185 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 10/52 (19%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.