DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and pb

DIOPT Version :9

Sequence 1:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:234 Identity:77/234 - (32%)
Similarity:100/234 - (42%) Gaps:69/234 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 TAGASLFQNAEPTSCSF----APNSQRSGYGPGAGAFASTVPGLYNVNSPLYQSPFASGYGLGAD 75
            ||....|.|::|:...|    :|.|.:.|...|:||....  |: |||..:       |.|:|  
  Fly    94 TASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGV--GV-NVNVNV-------GVGVG-- 146

Mouse    76 AYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMRSSGPDRK---------- 130
               .|.....|...|:         |...|             ||||:.....||          
  Fly   147 ---YPVGVVPQTPDGM---------DSVPE-------------YPWMKEKKTSRKSSNNNNQGDN 186

Mouse   131 -------------RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRM 182
                         |.|..||..|.||||||||||:||.|.||||||.:|.|||||:|:|||||||
  Fly   187 SITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRM 251

Mouse   183 KWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEE 221
            |    ||.::.:.| ..||...|:....|::|.....::
  Fly   252 K----HKRQTLSKT-DDEDNKDSLKGDDDQSDSNSNSKK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 3/4 (75%)
Homeobox 133..185 CDD:278475 38/51 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 8/36 (22%)
pbNP_476669.3 COG5576 168..274 CDD:227863 48/110 (44%)
Homeobox 202..254 CDD:278475 38/55 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.