DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and lab

DIOPT Version :9

Sequence 1:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:187 Identity:64/187 - (34%)
Similarity:78/187 - (41%) Gaps:51/187 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    42 PGAGAFASTVPGLYNVNSPLYQS---PFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKA 103
            ||.|...|....|...||.....   |...|.|||:.:             ||.|      |.  
  Fly   452 PGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGS-------------GLSS------CS-- 495

Mouse   104 DEGVLHGPAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 168
                                .|......||..:|..|..||||||||||||||.||||||:.|.|
  Fly   496 --------------------LSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQL 540

Mouse   169 TERQIKIWFQNRRMKWKKEHKDESQAPTAAPEDAVP--SVSTAADKADEEEEEEEEE 223
            .|.|:||||||||||.||..|:     ...|.|.:.  |.|..::|..::::.:..|
  Fly   541 NETQVKIWFQNRRMKQKKRVKE-----GLIPADILTQHSTSVISEKPPQQQQPQPPE 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 0/4 (0%)
Homeobox 133..185 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 8/40 (20%)
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.