DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa7 and CG11085

DIOPT Version :10

Sequence 1:NP_001406200.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:270 Species:Mus musculus
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:96 Identity:31/96 - (32%)
Similarity:47/96 - (48%) Gaps:23/96 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse   158 NG-AEANGTEGPDR----------------------KRGRQTYTRYQTLELEKEFHFNRYLTRRR 199
            || .:|||..||..                      :|.|..:|..|...||::|...:||:...
  Fly   125 NGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVAD 189

Mouse   200 RIEIAHALCLTERQIKIWFQNRRMKWKKEHK 230
            |.::|..|.|:|.|:|.|:||||.|||::::
  Fly   190 RSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa7NP_001406200.1 Homeodomain 171..227 CDD:459649 23/55 (42%)
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.