DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa6 and Ubx

DIOPT Version :9

Sequence 1:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:243 Identity:89/243 - (36%)
Similarity:121/243 - (49%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 SGQDSFLGQLPLYPA---------GY-DALRPFPASYGASSLPDKTYTSPCFYQQSN-----SVL 65
            :||::..|.:|:.|:         || |.....|.|:...|.......|.   ...|     |.:
  Fly   142 NGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSG---GNGNAGGVQSGV 203

Mouse    66 ACNRASYEYGASCFYSDKDLSGASPSGNNKQRGPGDYLHFSPEQQYKPDGSVQGKALHEEGTDRK 130
            ....|...:.|:|     .:|||:     .|......||.:....:.|..::.|:. .|:.|..|
  Fly   204 GVAGAGTAWNANC-----TISGAA-----AQTAAASSLHQASNHTFYPWMAIAGEC-PEDPTKSK 257

Mouse   131 YTSPVYPW--------MQRMNSCAGAV----YGSHG--RRGRQTYTRYQTLELEKEFHFNRYLTR 181
            ..|.:..:        .:...|.||::    .|::|  ||||||||||||||||||||.|.||||
  Fly   258 IRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTR 322

Mouse   182 RRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAK 229
            |||||:|:|||||||||||||||||||.|||.:.|.......:.::|:
  Fly   323 RRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 7/37 (19%)
Antp-type hexapeptide 135..140 0/12 (0%)
Homeobox 158..210 CDD:278475 47/51 (92%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.