DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa5 and Antp

DIOPT Version :9

Sequence 1:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:366 Identity:115/366 - (31%)
Similarity:143/366 - (39%) Gaps:126/366 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSSYFVNSFC------GRYP-NG----PDYQLHNYGDHSSVSEQFRDSASMHSGRYGYG------ 48
            |:|||.||:.      |.|| ||    ...|:|:|..:::           |.|...|.      
  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNAN-----------HQGNMPYPRFPPYD 64

Mouse    49 ----YNGMDL-----------------SVG-----RSGSGHFGSGERAR---------SYAAGAS 78
                |||..:                 .||     ...:|..|..::.:         .....|.
  Fly    65 RMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQ 129

Mouse    79 AAPAE-----PRYSQPATSTHSPPPDPL---PCS--------AVAPSPGS-------DSHH-GGK 119
            .||.:     |:.:|..|........|:   .|.        .:.|..||       ..|| ..:
  Fly   130 QAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQ 194

Mouse   120 NSLGNSSG-ASANAGSTHI------------------SSREGVGTASAAEE------DAPASSEQ 159
            .:|.:..| ..|..|.|.:                  ..:.||....|..:      ..|....|
  Fly   195 MTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQ 259

Mouse   160 A--GAQSEPSPAPPAQPQ-----IYPWMRKLHISHDNIGG-PEGKRARTAYTRYQTLELEKEFHF 216
            .  |..:.||..|.:|..     :|||||      ...|. .|.||.|..|||||||||||||||
  Fly   260 GHPGQHTPPSQNPNSQSSGMPSPLYPWMR------SQFGKCQERKRGRQTYTRYQTLELEKEFHF 318

Mouse   217 NRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 257
            ||||||||||||||||||:|||||||||||||||||:||.|
  Fly   319 NRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 28/150 (19%)
Antp-type hexapeptide 176..181 3/4 (75%)
Homeobox 199..252 CDD:333795 49/52 (94%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 32/150 (21%)
Homeobox 301..354 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.