DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa5 and bcd

DIOPT Version :10

Sequence 1:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:196 Identity:51/196 - (26%)
Similarity:76/196 - (38%) Gaps:58/196 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    96 PPPD------PLPCSAVAPSPGSDSH-HGGKNSLGNSSGASANAGSTHISSREGVGTASAAEEDA 153
            ||||      |||.:...|.|.|..| |           :..:....|            .:...
  Fly     4 PPPDQNFYHHPLPHTHTHPHPHSHPHPH-----------SHPHPHHQH------------PQLQL 45

Mouse   154 PAS---------SEQAGAQSE-------PSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAY 202
            |..         .|:.||.:.       |:..|  :|.::| ..:|   .|::.....:|.||.:
  Fly    46 PPQFRNPFDLLFDERTGAINYNYIRPYLPNQMP--KPDVFP-SEEL---PDSLVMRRPRRTRTTF 104

Mouse   203 TRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK------KDNKLKSMSM 261
            |..|..|||:.|...||||..|..:::..|.|...|:||||:|||.:.|      ||...:.|.:
  Fly   105 TSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPL 169

Mouse   262 A 262
            :
  Fly   170 S 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 19/101 (19%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeodomain 196..252 CDD:459649 25/61 (41%)
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 20/46 (43%)

Return to query results.
Submit another query.