DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxa4 and Antp

DIOPT Version :9

Sequence 1:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:342 Identity:107/342 - (31%)
Similarity:127/342 - (37%) Gaps:132/342 - (38%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 PKFPPFEEFAPHGGPG--------------------GG---DGAVGGGPGYP------------- 43
            |:|||::....:.|.|                    ||   .....|..|.|             
  Fly    58 PRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQN 122

Mouse    44 ----RPQSAP-----HLP-----APNPHAARQPPAYYAPRAREPSYPGGLYPAPAAACPYACRGA 94
                :.|.||     .||     ..:|...:|.|..|| ..:..:..|||...|        .|.
  Fly   123 QQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYA-SCKLQAAVGGLGMVP--------EGG 178

Mouse    95 SPARPEQS-----------PAPGAHP------------------------------SPAPQPPAP 118
            ||...:|.           |....||                              |..|...||
  Fly   179 SPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAP 243

Mouse   119 PR---HCAPGPTTPAVATGGSAPACPLLLADQGP-AGPKGKEPVVYPWMKKIHVSAVNSSYNG-G 178
            |:   |...||  |.:..|......|   ..|.| :...|....:||||:        |.:.. .
  Fly   244 PQGMMHQGQGP--PQMHQGHPGQHTP---PSQNPNSQSSGMPSPLYPWMR--------SQFGKCQ 295

Mouse   179 EPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPN 243
            |.||.|..|||.|.|||||||||||||||||||||||.|||:|||:|||||||||||||::|   
  Fly   296 ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK--- 357

Mouse   244 TKMRSSNTASAPAGPPG 260
            ||           |.||
  Fly   358 TK-----------GEPG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70 18/100 (18%)
Antp-type hexapeptide 159..164 3/4 (75%)
Homeobox 183..236 CDD:278475 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 6/23 (26%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/165 (21%)
Homeobox 301..354 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.