DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADRB2 and Dop1R1

DIOPT Version :9

Sequence 1:NP_000015.2 Gene:ADRB2 / 154 HGNCID:286 Length:413 Species:Homo sapiens
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:426 Identity:132/426 - (30%)
Similarity:208/426 - (48%) Gaps:67/426 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     8 SAFLLAPNGSHAPDHD-VTQERDE----VWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTV 67
            ::|....:.::|.:.| :..|..|    |.:|.:||.:|:::...|.||:||..||.....|:.:
  Fly    98 TSFYNESSWTNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRI 162

Human    68 TNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRY 132
            .|.|:.|||.|||.:...|:.|...:.|:..|.||..:|:.|.:.||:|.||||..||.|::|||
  Fly   163 GNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRY 227

Human   133 FAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAI---NCYANETCCDFF 194
            ..|..|.:|...:|:..|.:.|..:|:::...||:||.:..:| ..|..|   |.....||....
  Fly   228 IHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHR-PDQPLIFEDNGKKYPTCALDL 291

Human   195 TNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGH--- 256
            | ..||:.||.:|||.|.|:|:.:|.|::..|::            ||:::..|.:.|....   
  Fly   292 T-PTYAVVSSCISFYFPCVVMIGIYCRLYCYAQK------------HVKSIKAVTRPGEVAEKQR 343

Human   257 --GLRR----------------SSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLI 303
              .:||                ||.:.:.:|||..|:|:|||.|.:||:|||.|||........|
  Fly   344 YKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCI 408

Human   304 RKEVYILLNWIGYVNSGFNPLIY-CRSPDFRIAFQELLCLRR--SSLKAYGNGYSSNG------- 358
            ..:.:.:|.|:||.||.|||:|| ..:.:||.||:.:|.:|.  ...:..||.:..|.       
  Fly   409 GGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNIHPRNSDRFITDY 473

Human   359 --------NTGEQSGYHVEQEKENKL---LCEDLPG 383
                    |:|..|   .|.|:.:.:   .|.:|.|
  Fly   474 AAKNVVVMNSGRSS---AELEQVSAIXPKCCLNLTG 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADRB2NP_000015.2 7tmA_Beta2_AR 34..336 CDD:341355 111/326 (34%)
TM helix 1 36..60 CDD:341355 10/23 (43%)
TM helix 2 69..91 CDD:341355 10/21 (48%)
TM helix 3 107..129 CDD:341355 11/21 (52%)
TM helix 4 152..168 CDD:341355 4/15 (27%)
TM helix 5 197..220 CDD:341355 10/22 (45%)
TM helix 6 272..294 CDD:341355 12/21 (57%)
TM helix 7 305..330 CDD:341355 11/25 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..413
PDZ-binding 410..413
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 49/131 (37%)
7tm_1 145..431 CDD:278431 102/299 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.